PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_147745g0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family ZF-HD
Protein Properties Length: 94aa    MW: 10066.2 Da    PI: 6.8854
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_147745g0020genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.99e-322784260
     ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                    ++vrY eC+kNhAas+Gg+avDGC Efm+s g+egtaaa++CaAC+CHR+FHR+eve+e
  MA_147745g0020 27 KSVRYGECRKNHAASIGGYAVDGCAEFMAS-GDEGTAAAMRCAACNCHRSFHRKEVENE 84
                    579**************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-222790IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047707.0E-302981IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.4E-263081IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.7663180IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MGPSEIVQQI EAGSAGTARE GDIASRKSVR YGECRKNHAA SIGGYAVDGC AEFMASGDEG  60
TAAAMRCAAC NCHRSFHRKE VENETLCECH RISR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1082341e-141BT108234.1 Picea glauca clone GQ03118_L05 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008792497.13e-34PREDICTED: mini zinc finger protein 1-like
SwissprotQ9LJW54e-30MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA9NK894e-47A9NK89_PICSI; Putative uncharacterized protein
STRINGVIT_08s0056g01130.t012e-29(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.12e-31mini zinc finger 2